DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3982 and ATAT1

DIOPT Version :9

Sequence 1:NP_729490.1 Gene:CG3982 / 39084 FlyBaseID:FBgn0035988 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001026892.1 Gene:ATAT1 / 79969 HGNCID:21186 Length:409 Species:Homo sapiens


Alignment Length:344 Identity:66/344 - (19%)
Similarity:110/344 - (31%) Gaps:108/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ASRHAAGGGVAPAVGRKQVSQVSLTPSQSRNTNATENPLKSPLD-----ALSRSGPVRNQNPFQR 89
            :|...||.|.  .:|..:|....|.....|..:....|| ..||     ::.|.|  ..:..||.
Human    71 SSARPAGKGA--IIGFIKVGYKKLFVLDDREAHNEVEPL-CILDFYIHESVQRHG--HGRELFQY 130

  Fly    90 RSGLQDVDEAFLASNIFARPSRV------RHSGLDREIMPQAAVGGAVAG--GQQASPPIPTQQQ 146
            ....:.|:...||.:   |||:.      :|..|:..: ||........|  ..|..||.|:.  
Human   131 MLQKERVEPHQLAID---RPSQKLLKFLNKHYNLETTV-PQVNNFVIFEGFFAHQHRPPAPSL-- 189

  Fly   147 HHQQQQQQQYQQIPPVDAVPQQQMAPPAV---VPQQQQMQQQYV-----------QQPAAGQPTR 197
              :..:..:...:.|..|.|.:::.|...   :.......::::           :.|....|..
Human   190 --RATRHSRAAAVDPTPAAPARKLPPKRAEGDIKPYSSSDREFLKVAVEPPWPLNRAPRRATPPA 252

  Fly   198 MDPPPSG-----------RAHVHQQQV--------PH-------------QQQQMQHQQQMP--- 227
            ..||.|.           |..|.:|::        ||             ...|.:..:..|   
Human   253 HPPPRSSSLGNSPERGPLRPFVPEQELLRSLRLCPPHPTARLLLAADPGGSPAQRRRTRGTPPGL 317

  Fly   228 -----------------PQTGYEQQQQQVIQPDAQMQNKYANQQQQQHQ----LQPQHQSPLNGY 271
                             |.||.:..:    |.:.:.:|:.|:::|...|    .:|.|       
Human   318 VAQSCCYSRHGGVNSSSPNTGNQDSK----QGEQETKNRSASEEQALSQDGSGEKPMH------- 371

  Fly   272 PSQPPNAVAPQATMPTTGG 290
             :.||.|.||.|...|.||
Human   372 -TAPPQAPAPPAQSWTVGG 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3982NP_729490.1 None
ATAT1NP_001026892.1 Acetyltransf_16 10..178 CDD:310130 27/115 (23%)
EBV-NA3 <183..312 CDD:332796 18/132 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.