DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3982 and CG17003

DIOPT Version :9

Sequence 1:NP_729490.1 Gene:CG3982 / 39084 FlyBaseID:FBgn0035988 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster


Alignment Length:112 Identity:25/112 - (22%)
Similarity:34/112 - (30%) Gaps:39/112 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RPSR------VRHSGLDREIMPQA--------------AVGGAVAGGQQASPPIPTQQQHHQQQQ 152
            |||.      .:|.||.|.| ||.              ....:.:|.|.......::.|.|..:|
  Fly   161 RPSNKMLAFMAKHYGLVRTI-PQGNNFVLYEGFFDDPITTCKSASGLQATGSGCRSRSQGHYVRQ 224

  Fly   153 QQQYQQIPPVDAVPQQQMAPPAVVPQQQQMQQQYVQQPAAGQPTRMD 199
            :|...||                  :..|..:..||..|...|.|.|
  Fly   225 EQDQAQI------------------KHGQANRNTVQNDANSGPFRQD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3982NP_729490.1 None
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.