DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3982 and ttn-1

DIOPT Version :10

Sequence 1:NP_729490.1 Gene:CG3982 / 39084 FlyBaseID:FBgn0035988 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001346715.1 Gene:ttn-1 / 266969 WormBaseID:WBGene00006436 Length:15188 Species:Caenorhabditis elegans


Alignment Length:258 Identity:65/258 - (25%)
Similarity:100/258 - (38%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DVDEAFLASNI--FARPSR------------VRHSGLDREIMPQAAVGGAVAGG--QQASPPIPT 143
            ::.|.|....:  .|.||.            :..|.:.:|:...||........  ::|:|..|:
 Worm  1945 EIIEKFTEEEVPKVAEPSEPTQADVPKIAAPLEQSQIQQEVPTVAAPSEPTQADVPKEAAPSEPS 2009

  Fly   144 QQQHHQ----QQQQQQYQQIPPVDA--VPQQQMAPPAVVP-QQQQMQQQYVQQPAAGQPTRMDPP 201
            |....:    .:|.|..|::|.|.|  .|.|...|....| :|.|:||:.....|..:||:.|.|
 Worm  2010 QADVPKVAAPLEQTQIQQEVPMVAAPLEPTQADVPKVAAPLEQSQIQQEVPTVAAPSEPTQADVP 2074

  Fly   202 ----PSGRAHVHQQQVPHQQQQMQHQQQMPPQTG-YEQQQQQVIQPDAQMQNKYANQQQQQHQLQ 261
                ||..:.....:|....:|.|.||::|.... .|..|::|.:..|..:....:..:....|:
 Worm  2075 KEAAPSEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPIQEEVPKEAAPSEPTQEDVPKGAAPLE 2139

  Fly   262 P-QHQSPLNGYPSQP-----PNAVAP-QATMPTTGGGAAPAPGATGGSNAPRENAGGSAAPAE 317
            | |...|....||.|     |...|| :.|.......|||       |...:||....|||:|
 Worm  2140 PTQEDVPKEAAPSGPTQEDVPKEEAPSEPTQEDVPKEAAP-------SEPTQENVPKEAAPSE 2195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3982NP_729490.1 None
ttn-1NP_001346715.1 IG_like 105..177 CDD:214653
Ig strand B 107..111 CDD:409353
Ig strand C 120..124 CDD:409353
Ig strand E 146..150 CDD:409353
Ig strand F 157..162 CDD:409353
Ig_3 205..280 CDD:464046
Ig 406..493 CDD:472250
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353
Ig strand E 462..466 CDD:409353
Ig strand F 474..479 CDD:409353
Ig strand G 487..490 CDD:409353
Ig 821..914 CDD:472250
Ig strand B 838..842 CDD:409353
Ig strand C 851..855 CDD:409353
Ig strand E 880..884 CDD:409353
Ig strand F 894..899 CDD:409353
Ig strand G 907..910 CDD:409353
Ig 962..1030 CDD:409353
Ig strand B 962..966 CDD:409353
Ig strand C 975..979 CDD:409353
Ig strand E 1000..1005 CDD:409353
Ig strand F 1015..1020 CDD:409353
Ig 1135..1215 CDD:472250
Ig strand B 1152..1156 CDD:409353
Ig strand C 1165..1169 CDD:409353
Ig strand E 1190..1194 CDD:409353
Ig strand F 1204..1209 CDD:409353
Ig strand G 1217..1220 CDD:409353
I-set 1679..1767 CDD:400151
Ig strand B 1696..1700 CDD:409353
Ig strand C 1709..1713 CDD:409353
Ig strand E 1734..1738 CDD:409353
Ig strand F 1748..1753 CDD:409353
IG_like 1789..>1844 CDD:214653
Ig strand B 1789..1793 CDD:409353
Ig strand C 1801..1805 CDD:409353
Ig strand E 1829..1833 CDD:409353
Ig strand F 1843..1847 CDD:409353
Ig strand G 1856..1859 CDD:409353
PHA03247 <1957..2285 CDD:223021 63/246 (26%)
Ig 2381..2468 CDD:472250
Ig strand B 2398..2402 CDD:409353
Ig strand C 2411..2415 CDD:409353
Ig strand E 2437..2441 CDD:409353
Ig strand F 2451..2456 CDD:409353
Ig strand G 2464..2467 CDD:409353
Ig 2489..2578 CDD:472250
Ig strand B 2507..2511 CDD:409353
Ig strand C 2520..2524 CDD:409353
Ig strand E 2544..2548 CDD:409353
Ig strand F 2558..2563 CDD:409353
Ig strand G 2573..2576 CDD:409353
Ig 2631..2717 CDD:472250
Ig strand B 2647..2651 CDD:409353
Ig strand C 2660..2664 CDD:409353
Ig strand E 2685..2689 CDD:409353
Ig strand F 2698..2703 CDD:409353
Ig strand G 2711..2714 CDD:409353
Ig 2749..2806 CDD:472250
Ig strand B 2749..2752 CDD:409353
Ig strand C 2761..2765 CDD:409353
Ig strand E 2784..2787 CDD:409353
Ig strand F 2795..2800 CDD:409353
Ig strand B 2836..2846 CDD:409353
Ig <2848..2913 CDD:472250
Ig strand C 2855..2859 CDD:409353
Ig strand E 2877..2881 CDD:409353
Ig strand F 2893..2898 CDD:409353
Ig strand G 2906..2909 CDD:409353
Ig 2924..3007 CDD:472250
rne <3161..3303 CDD:236766
rne <3356..3556 CDD:236766
rne <3506..3673 CDD:236766
rne <3595..3803 CDD:236766
rne <3722..3912 CDD:236766
rne <3875..4073 CDD:236766
PRK10263 <4014..>4556 CDD:236669
rne <4346..4567 CDD:236766
rne <4525..4723 CDD:236766
rne <4746..4936 CDD:236766
rne <4858..5044 CDD:236766
PRK10263 <4960..>5541 CDD:236669
PTZ00121 <5525..6250 CDD:173412
PTZ00121 <6198..6681 CDD:173412
tolA <6559..>6683 CDD:236545
Ig 7448..7535 CDD:472250
Ig strand B 7466..7470 CDD:319246
Ig strand C 7479..7483 CDD:319246
Ig strand E 7502..7506 CDD:319246
FN3 <7516..7762 CDD:442628
Ig strand F 7516..7521 CDD:319246
Ig strand G 7529..7532 CDD:319246
FN3 7540..7630 CDD:238020
PTZ00121 <7944..8780 CDD:173412
Ig 8875..>8935 CDD:472250
Ig strand B 8884..8887 CDD:409353
Ig strand C 8895..8899 CDD:409353
Ig strand E 8921..8925 CDD:409353
FN3 9052..9142 CDD:238020
PTZ00121 <9210..9875 CDD:173412
PTZ00121 <9583..10392 CDD:173412
IG_like 10597..>10662 CDD:214653
Ig strand B 10608..10612 CDD:409353
Ig strand C 10622..10626 CDD:409353
Ig strand E 10647..10651 CDD:409353
Ig strand F 10661..10666 CDD:409353
Ig strand G 10670..10673 CDD:409353
Ig <10711..10773 CDD:472250
Ig strand C 10712..10716 CDD:409353
Ig strand E 10739..10743 CDD:409353
Ig strand F 10753..10758 CDD:409353
FN3 <10754..>10967 CDD:442628
Ig strand G 10766..10769 CDD:409353
FN3 10984..11070 CDD:238020
Ig 11077..11165 CDD:472250
Ig strand B 11094..11098 CDD:409353
Ig strand C 11107..11111 CDD:409353
Ig strand E 11133..11137 CDD:409353
Ig strand F 11147..11152 CDD:409353
Ig strand G 11160..11163 CDD:409353
Ig 11183..11254 CDD:472250
Ig strand B 11190..11194 CDD:409353
Ig strand C 11202..11206 CDD:409353
Ig strand E 11227..11231 CDD:409353
Ig strand F 11241..11246 CDD:409353
Ig strand G 11250..11253 CDD:409353
Ig 11264..11350 CDD:472250
Ig strand B 11282..11286 CDD:409353
Ig strand C 11294..11298 CDD:409353
Ig strand E 11317..11324 CDD:409353
Ig strand G 11345..11348 CDD:409353
Ig 11368..11446 CDD:472250
FN3 <11450..>11657 CDD:442628
Ig 11823..11903 CDD:472250
Ig 11918..11996 CDD:472250
Ig strand B 11926..11930 CDD:409353
Ig strand C 11938..11942 CDD:409353
Ig strand E 11963..11968 CDD:409353
Ig strand F 11978..11983 CDD:409353
FN3 <11979..12306 CDD:442628
Ig strand G 11991..11994 CDD:409353
Ig 12335..12411 CDD:472250
Ig strand B 12338..12342 CDD:409353
Ig strand C 12351..12356 CDD:409353
Ig strand E 12377..12381 CDD:409353
Ig strand F 12391..12396 CDD:409353
Ig strand G 12404..12407 CDD:409353
FN3 12415..12503 CDD:238020
Protein Kinases, catalytic domain 12566..12815 CDD:473864
I-set 12894..12985 CDD:400151
Ig strand B 12912..12916 CDD:409353
Ig strand C 12925..12929 CDD:409353
Ig strand E 12951..12955 CDD:409353
Ig strand F 12965..12970 CDD:409353
Ig 13024..13114 CDD:472250
Ig strand B 13041..13045 CDD:409353
Ig strand C 13054..13058 CDD:409353
Ig strand E 13080..13084 CDD:409353
Ig strand F 13094..13099 CDD:409353
Ig strand G 13107..13110 CDD:409353
I-set 13123..13206 CDD:400151
Ig strand B 13140..13144 CDD:409353
Ig strand C 13153..13157 CDD:409353
Ig strand E 13180..13184 CDD:409353
Ig strand F 13194..13199 CDD:409353
Ig 13249..13317 CDD:409353
Ig strand B 13249..13253 CDD:409353
Ig strand C 13262..13266 CDD:409353
Ig strand E 13286..13290 CDD:409353
Ig strand F 13300..13305 CDD:409353
Ig strand G 13314..13317 CDD:409353
I-set 13331..13421 CDD:400151
Ig strand B 13349..13352 CDD:409353
Ig strand C 13361..13365 CDD:409353
Ig strand E 13387..13391 CDD:409353
Ig strand F 13401..13406 CDD:409353
I-set 13456..13545 CDD:400151
Ig strand B 13473..13477 CDD:409353
Ig strand C 13486..13490 CDD:409353
Ig strand E 13511..13515 CDD:409353
Ig strand F 13525..13530 CDD:409353
Ig strand G 13538..13541 CDD:409353
Ig 13558..13650 CDD:472250
Ig strand B 13576..13580 CDD:409353
Ig strand C 13589..13593 CDD:409353
Ig strand E 13614..13620 CDD:409353
Ig strand F 13630..13635 CDD:409353
Ig strand G 13643..13646 CDD:409353
I-set 13663..13753 CDD:400151
Ig strand B 13681..13685 CDD:409353
Ig strand C 13694..13698 CDD:409353
Ig strand E 13719..13723 CDD:409353
Ig strand F 13733..13738 CDD:409353
Ig strand G 13746..13749 CDD:409353
FN3 13778..13864 CDD:238020
Ig 13893..13963 CDD:472250
Ig strand B 13893..13897 CDD:409353
Ig strand C 13906..13910 CDD:409353
Ig strand E 13931..13935 CDD:409353
Ig strand F 13943..13948 CDD:409353
Ig strand G 13956..13959 CDD:409353
Ig 13984..14074 CDD:472250
Ig strand B 14001..14005 CDD:409353
Ig strand C 14014..14018 CDD:409353
Ig strand E 14040..14044 CDD:409353
Ig strand F 14054..14059 CDD:409353
I-set 14083..14168 CDD:400151
Ig strand B 14100..14104 CDD:409353
Ig strand C 14113..14117 CDD:409353
Ig strand E 14139..14143 CDD:409353
Ig strand F 14153..14158 CDD:409353
Ig strand G 14166..14169 CDD:409353
Ig_3 14195..14275 CDD:464046
Ig 14302..14397 CDD:472250
Ig strand B 14319..14323 CDD:409353
Ig strand C 14332..14336 CDD:409353
Ig strand E 14350..14367 CDD:409353
Ig strand F 14377..14382 CDD:409353
Ig strand G 14390..14393 CDD:409353
Ig 14408..14498 CDD:472250
Ig strand B 14425..14429 CDD:409353
Ig strand C 14438..14442 CDD:409353
Ig strand E 14464..14468 CDD:409353
Ig strand F 14478..14483 CDD:409353
Ig strand G 14491..14494 CDD:409353
Ig 14634..14724 CDD:472250
Ig strand B 14652..14656 CDD:409353
Ig strand C 14665..14669 CDD:409353
Ig strand E 14690..14694 CDD:409353
Ig strand F 14704..14709 CDD:409353
Ig strand G 14717..14720 CDD:409353
IG_like 14754..14838 CDD:214653
Ig strand B 14765..14769 CDD:409353
Ig strand C 14778..14782 CDD:409353
Ig strand E 14804..14808 CDD:409353
Ig strand F 14818..14823 CDD:409353
Ig strand G 14831..14834 CDD:409353
Ig 14854..14943 CDD:472250
Ig strand B 14870..14874 CDD:409353
Ig strand C 14884..14888 CDD:409353
Ig strand E 14909..14913 CDD:409353
Ig strand F 14923..14928 CDD:409353
Ig strand G 14936..14939 CDD:409353
I-set 14969..15044 CDD:400151
Ig strand B 14972..14976 CDD:409353
Ig strand C 14985..14989 CDD:409353
Ig strand E 15010..15014 CDD:409353
Ig strand F 15024..15029 CDD:409353
Ig strand G 15037..15040 CDD:409353
Ig_3 15054..15132 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.