DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3982 and atat-2

DIOPT Version :9

Sequence 1:NP_729490.1 Gene:CG3982 / 39084 FlyBaseID:FBgn0035988 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001379875.1 Gene:atat-2 / 180852 WormBaseID:WBGene00021059 Length:263 Species:Caenorhabditis elegans


Alignment Length:101 Identity:22/101 - (21%)
Similarity:35/101 - (34%) Gaps:33/101 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VGRKQVSQVSLTPSQSRNTNATENPLKSPLDALSRSGPVRNQNPFQRRSGLQDVDEAFLASNIFA 107
            :||...  |..||.|::..:...:       |:|.....||.:|..|                  
 Worm   182 IGRHPT--VPFTPRQTKRASRASS-------AVSSHASSRNTSPIGR------------------ 219

  Fly   108 RPSRVRHSGLDREIMPQAAVGGAVAGGQQASPPIPT 143
              :|.||..: .::|.|..:.|..|   :..|..||
 Worm   220 --NRPRHDSV-ADLMRQDMLAGVRA---EVDPNSPT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3982NP_729490.1 None
atat-2NP_001379875.1 Acetyltransf_16 8..181 CDD:398794
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.