powered by:
Protein Alignment CG3982 and atat-2
DIOPT Version :9
Sequence 1: | NP_729490.1 |
Gene: | CG3982 / 39084 |
FlyBaseID: | FBgn0035988 |
Length: | 349 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379875.1 |
Gene: | atat-2 / 180852 |
WormBaseID: | WBGene00021059 |
Length: | 263 |
Species: | Caenorhabditis elegans |
Alignment Length: | 101 |
Identity: | 22/101 - (21%) |
Similarity: | 35/101 - (34%) |
Gaps: | 33/101 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 VGRKQVSQVSLTPSQSRNTNATENPLKSPLDALSRSGPVRNQNPFQRRSGLQDVDEAFLASNIFA 107
:||... |..||.|::..:...: |:|.....||.:|..|
Worm 182 IGRHPT--VPFTPRQTKRASRASS-------AVSSHASSRNTSPIGR------------------ 219
Fly 108 RPSRVRHSGLDREIMPQAAVGGAVAGGQQASPPIPT 143
:|.||..: .::|.|..:.|..| :..|..||
Worm 220 --NRPRHDSV-ADLMRQDMLAGVRA---EVDPNSPT 249
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3982 | NP_729490.1 |
None |
atat-2 | NP_001379875.1 |
Acetyltransf_16 |
8..181 |
CDD:398794 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4601 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.