DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3982 and mec-17

DIOPT Version :9

Sequence 1:NP_729490.1 Gene:CG3982 / 39084 FlyBaseID:FBgn0035988 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_501337.1 Gene:mec-17 / 177596 WormBaseID:WBGene00003178 Length:262 Species:Caenorhabditis elegans


Alignment Length:130 Identity:28/130 - (21%)
Similarity:44/130 - (33%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 HVH---QQQVPHQQ--QQMQHQQQMPPQ-----------TGYEQQQQQVIQPDAQMQNKYANQQQ 255
            :||   |:|...||  ..|..|:...|.           .|:..|:..:|:|..|..| :...::
 Worm   112 YVHFSCQRQGVGQQILDYMFSQEHTEPYQLALDNPSVTLLGFMSQKYGLIKPVWQNTN-FVVFEE 175

  Fly   256 QQHQLQPQHQSPLNGYPSQPPNAVAPQATMPTTGGGAAPAPGATGGSNAPRENAGGSAAPAEAEM 320
            ....|..:     ||....||:......|....|.|...........:..:......|||.:|:|
 Worm   176 LFLALSAE-----NGIEKPPPDGWRRPMTPRRLGTGMTDTRWLQHAVSGHQSKGNAMAAPVDADM 235

  Fly   321  320
             Worm   236  235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3982NP_729490.1 None
mec-17NP_501337.1 Mec-17 67..177 CDD:283063 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.