DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpsf5 and CFIM-25

DIOPT Version :9

Sequence 1:NP_001036597.1 Gene:Cpsf5 / 39083 FlyBaseID:FBgn0035987 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_567835.1 Gene:CFIM-25 / 829104 AraportID:AT4G29820 Length:222 Species:Arabidopsis thaliana


Alignment Length:222 Identity:96/222 - (43%)
Similarity:137/222 - (61%) Gaps:5/222 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSQGQA-DAASSNNNGTQKYTNQALTINRTINLYPLTNYTFGTKEPLFEKDPSVPSRFQRMREEF 81
            |.:.:| |....::|.|::   ..:..:..::||||::|.||:||.|..||..:..|..|::..:
plant     2 GEEARALDMEEISDNTTRR---NDVVHDLMVDLYPLSSYYFGSKEALRVKDEIISDRVIRLKSNY 63

  Fly    82 DRIGMRRSVEGVLLVHEHGLPHVLLLQLGTTFFKLPGGELNAGEDEVEGLKRLLSETLGRQDGV- 145
            ...|:|..||.||||.....|||||||...:.||||||.|..||.::|||||.|:..|...:.| 
plant    64 AAHGLRTCVEAVLLVELFKHPHVLLLQYRNSIFKLPGGRLRPGESDIEGLKRKLASKLSVNENVG 128

  Fly   146 KQEWIVEDTIGNWWRPNFEPPQYPYIPPHITKPKEHKRLFLVQLHEKALFAVPKNYKLVAAPLFE 210
            ...:.|.:.||.|||||||...||::||:|..|||..:||||:|.....|.||||:||:|.||.:
plant   129 VSGYEVGECIGMWWRPNFETLMYPFLPPNIKHPKECTKLFLVRLPVHQQFVVPKNFKLLAVPLCQ 193

  Fly   211 LYDNSQGYGPIISSLPQALCRFNFIYM 237
            |::|.:.||||:|.:|:.|.:|:|..|
plant   194 LHENEKTYGPIMSQIPKLLSKFSFNMM 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpsf5NP_001036597.1 NUDIX_2 45..232 CDD:404710 88/187 (47%)
CFIM-25NP_567835.1 NUDIX_2 28..215 CDD:290580 88/186 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54579
OrthoDB 1 1.010 - - D1194206at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13047
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4023
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.