DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpsf5 and nudt21

DIOPT Version :9

Sequence 1:NP_001036597.1 Gene:Cpsf5 / 39083 FlyBaseID:FBgn0035987 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001017262.1 Gene:nudt21 / 550016 XenbaseID:XB-GENE-921415 Length:227 Species:Xenopus tropicalis


Alignment Length:231 Identity:179/231 - (77%)
Similarity:196/231 - (84%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NKSGSGWPRRGSQGQADAASSNNNGTQKYTNQA--LTINRTINLYPLTNYTFGTKEPLFEKDPSV 70
            |:|.:||||           ..|....||..|.  ||:.|||||||||||||||||||:|||.||
 Frog     7 NRSQTGWPR-----------GVNQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV 60

  Fly    71 PSRFQRMREEFDRIGMRRSVEGVLLVHEHGLPHVLLLQLGTTFFKLPGGELNAGEDEVEGLKRLL 135
            .:||||||||||:|||||:|||||:||||.||||||||||||||||||||||.|||||||||||:
 Frog    61 AARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLM 125

  Fly   136 SETLGRQDGVKQEWIVEDTIGNWWRPNFEPPQYPYIPPHITKPKEHKRLFLVQLHEKALFAVPKN 200
            :|.|||||||:|:|:::|.||||||||||||||||||.|||||||||:||||||.||||||||||
 Frog   126 TEILGRQDGVQQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKN 190

  Fly   201 YKLVAAPLFELYDNSQGYGPIISSLPQALCRFNFIY 236
            ||||||||||||||:.|||||||||||.|.||||||
 Frog   191 YKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpsf5NP_001036597.1 NUDIX_2 45..232 CDD:404710 161/186 (87%)
nudt21NP_001017262.1 NUDIX_2 35..222 CDD:372769 161/186 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 344 1.000 Domainoid score I1049
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5090
Inparanoid 1 1.050 358 1.000 Inparanoid score I2171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194206at2759
OrthoFinder 1 1.000 - - FOG0006316
OrthoInspector 1 1.000 - - oto103792
Panther 1 1.100 - - LDO PTHR13047
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4135
SonicParanoid 1 1.000 - - X4023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.