DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4022 and pih1d2

DIOPT Version :9

Sequence 1:NP_001246696.1 Gene:CG4022 / 39082 FlyBaseID:FBgn0035986 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_009289837.1 Gene:pih1d2 / 494086 ZFINID:ZDB-GENE-041212-54 Length:341 Species:Danio rerio


Alignment Length:268 Identity:66/268 - (24%)
Similarity:106/268 - (39%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PHSY-----RHSRAYRHFKNPPQPHMCIRTTTEAGEE--LFINVLSWTRIVIPQEPSDPIPLYGG 147
            |..|     |..|....|.:|||||.||||......|  |:||:..|.|:..|....:|:|:.||
Zfish    30 PEEYRSFIQRQMREGAEFHSPPQPHTCIRTAVLGANEGILYINICGWKRVPAPASDKEPVPVCGG 94

  Fly   148 MRVPPGSPRSPPIVFAVMANPEVLKDSGRHSKDPEERRAMVELMCDFVEAMNPGVKLVRNAVILK 212
            ........:....|.....|||||:.:   .||.||:..:..|..:|::..: .:.|.::..:..
Zfish    95 RMEKLTEEKEEYSVVDAAFNPEVLQTT---EKDKEEKENLCLLALNFIQQQH-NLTLSQHYKLTN 155

  Fly   213 DRDISGELKDVWNAVQAQR---------DREREEQMMQQRQQQHYQNITTQQMFPKSPDAS---- 264
            |: |.|..:|:...:.:.:         ..|....::||        |.:.|......|:|    
Zfish   156 DK-IKGSFRDMKQRLMSTKTCKSTLNGSQSEPAPSLLQQ--------ICSLQNTESDEDSSIELS 211

  Fly   265 -----RAASAG----AAVNEASSPPAHLSEPLLVEQGNGNGNGITLAVFAQQLDNKVASEQGEQQ 320
                 :.|.:|    .:..|...|...|.:..|....:|||:...|     ||..::...:...|
Zfish   212 IEQERKPARSGLIEVISSTELDQPQPQLPKHQLTICPDGNGSSRIL-----QLCVELPGVRSVSQ 271

  Fly   321 EQSPVSED 328
            .|..:|||
Zfish   272 CQLRISED 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4022NP_001246696.1 alpha-crystallin-Hsps_p23-like 106..>196 CDD:294116 31/91 (34%)
pih1d2XP_009289837.1 alpha-crystallin-Hsps_p23-like 51..318 CDD:294116 60/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto38742
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22997
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.