DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4022 and Dnaaf2

DIOPT Version :10

Sequence 1:NP_648307.1 Gene:CG4022 / 39082 FlyBaseID:FBgn0035986 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_081545.3 Gene:Dnaaf2 / 109065 MGIID:1923566 Length:814 Species:Mus musculus


Alignment Length:71 Identity:20/71 - (28%)
Similarity:29/71 - (40%) Gaps:19/71 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKATKSRDGSGQVVPLTEPVVTATGMVGTRSWIGGLFTRSNRRQDKAVDYTLSPLQEERLQRLQD 72
            |.:..:.|||.|     :|.:.|..|    ||:..|        .:.|..|:..|.||.::.|..
Mouse   205 KMSLLTEDGSKQ-----DPQLPAHHM----SWVSDL--------TQNVISTVLLLSEELIEELNP 252

  Fly    73 RMVVPF 78
              ||.|
Mouse   253 --VVEF 256

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4022NP_648307.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 106..>196 CDD:469641