DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67B and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:161 Identity:46/161 - (28%)
Similarity:58/161 - (36%) Gaps:43/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EHYDAH-QYHGQDGLGQFAYGYRDW----NQGKNEKRDETGKVT-GSYKYVQPHGRDFVANYYAD 140
            |.||.| ||       :|:||..|.    |:|:.|:||  |.|. |.|..:...|...:..|.||
  Fly    54 EEYDPHPQY-------RFSYGVDDKLTGDNKGQVEERD--GDVVRGEYSLIDADGYKRIVQYTAD 109

  Fly   141 K-TGFHVEDNRPAHLK----LPATKT------------------PAVLK--AEEEHFKLWG--EL 178
            . .||:...||...:|    .|..||                  |||:|  |...|:....  :.
  Fly   110 PINGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKT 174

  Fly   179 AAAAGHNPDPYA-AEYQQEGRYQPTEPEYQP 208
            .|...|...|.| |.|.....|......|.|
  Fly   175 VAPVAHYAAPAAYATYAAPTHYAAPAVAYHP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:459790 11/34 (32%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 18/60 (30%)

Return to query results.
Submit another query.