DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67B and Ccp84Af

DIOPT Version :10

Sequence 1:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:113 Identity:31/113 - (27%)
Similarity:43/113 - (38%) Gaps:24/113 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EHYDAH-QYHGQDGLGQFAYGYRDWNQG--KNEKRDETGKVT-GSYKYVQPHGRDFVANYYADK- 141
            |.||.| ||       :|||..:|...|  |::..:..|.|. |.|..:...|...:..|.:|. 
  Fly    54 EEYDPHPQY-------KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPV 111

  Fly   142 TGFHVEDNRPAHLKLPATKTPAVLKAEEEHFKLWGELAAAAGHNPDPY 189
            .||:...||     :|......|:|..       ..:|.||...|..|
  Fly   112 NGFNAVVNR-----VPLDHVKTVVKTV-------APVAVAAAPIPVAY 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:459790 7/34 (21%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 14/58 (24%)

Return to query results.
Submit another query.