DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67B and Cpr66D

DIOPT Version :9

Sequence 1:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:238 Identity:55/238 - (23%)
Similarity:86/238 - (36%) Gaps:62/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GENIFKINITPEEAQQFLNSAQLRGIGD-----------------------------IEYAPKTG 52
            |..||:.|  .|:.||::||.|...|.|                             ..|.|...
  Fly    49 GTPIFEQN--SEQTQQYVNSGQQIRIKDTVAEQIRAQQQQGYVAPSVRDYQQYQPQQAAYRPPAQ 111

  Fly    53 ENPLPEARNEKGEFVYMGRVIEHPEEY---VEEHYDAHQYHGQDGLGQFAYGYRD--WNQGKNEK 112
            ..|.|..|.::..:......|....::   :::..:..:|..|:...||.:..:|  :...:|.|
  Fly   112 AAPQPPRRIQQSSYQAPSTSILGKGQHKLSLQQQNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRK 176

  Fly   113 RDETGKV-TGSYKYVQPHGRDFVANYYAD-KTGFHVEDNR-PAHL--KLPATKTPAVL------K 166
            ....|.| .|||..|...|......|.|| |.||..|..| |..:  |:|....|..|      |
  Fly   177 EIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPTQLLRAGGHK 241

  Fly   167 AEEEHFKLWGELAAAAGHNPDPYAAEYQQEGRYQPTEPEYQPY 209
            |::|:         ::|.:...|..:.||:      :|:|..|
  Fly   242 AQQEY---------SSGPSKQQYQHQQQQQ------QPQYHQY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 12/34 (35%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.