DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67B and resilin

DIOPT Version :10

Sequence 1:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:143 Identity:36/143 - (25%)
Similarity:48/143 - (33%) Gaps:55/143 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TRSNRRQDKAVDYTL---SPLQEERLQRLQDRMVVPFDETRPDHQESLK-ALWNVAFPNVHLTGL 73
            |..:.|:...:||.|   .|......|      ||||..|.||   ||. |:| |.|.....||:
  Fly  2538 TGDDCRKSVQIDYDLYFSDPYHSSASQ------VVPFYTTAPD---SLTLAMW-VQFAQKDDTGI 2592

  Fly    74 VTEQWKEMGWQGPNPSTDFRGCGFIALENLLFSARTYPVCFRRLLLKQRGDRAKWEYPFAVAGIN 138
                                   ||.    |:||....|..:|..:.|...          :|:.
  Fly  2593 -----------------------FIT----LYSANAPNVITKRRTMLQAHS----------SGVQ 2620

  Fly   139 ISFMLIQMLDLQN 151
            :||    ..|||:
  Fly  2621 VSF----FDDLQD 2629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:459790 6/32 (19%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.