DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67B and Cpr30B

DIOPT Version :10

Sequence 1:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:93 Identity:23/93 - (24%)
Similarity:37/93 - (39%) Gaps:13/93 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 AHQYHGQDGLGQFAYGYR---------DWNQGKNEKRDETGKVTGSYKYVQPHGRDFVANYYA-D 140
            |.:...:...|..||.::         |....|..::|:  ||.|.|:.:...|...:..|.| |
  Fly    19 AIELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDD--KVEGVYELIDSDGYRRIVQYKADD 81

  Fly   141 KTGFH-VEDNRPAHLKLPATKTPAVLKA 167
            ..||. :....|..:|:|..:.|..|.|
  Fly    82 HNGFEAIVQREPTDIKIPLPEPPKKLLA 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:459790 9/33 (27%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 12/53 (23%)

Return to query results.
Submit another query.