DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67B and Cpr5C

DIOPT Version :10

Sequence 1:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:136 Identity:34/136 - (25%)
Similarity:43/136 - (31%) Gaps:50/136 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EEHYDAH-QYHGQDGLGQFAYGYRDWNQG--KNEKRDETGKVT-GSYKYVQPHGRDFVANYYADK 141
            :|.||.| ||       ::||..:|...|  |::..:..|.|. |.|..|...|......|.||.
  Fly    55 DEEYDPHPQY-------KYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADP 112

  Fly   142 -TGFHVEDNRPAHLKLPATKTPAVLKAEEEHFKLWGELAAAAGHNPDPYAAEYQQEGRYQPTEPE 205
             .||:...||.     |..||  |:|.                               ..|..|.
  Fly   113 INGFNAVVNRE-----PLVKT--VVKT-------------------------------VAPVAPV 139

  Fly   206 YQPYVH 211
            |..|.|
  Fly   140 YAAYHH 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:459790 9/34 (26%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 15/58 (26%)

Return to query results.
Submit another query.