DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and SSM4

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_012234.3 Gene:SSM4 / 854781 SGDID:S000001292 Length:1319 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:39/120 - (32%)
Similarity:59/120 - (49%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETN--------SCELCKFPFIM 95
            ||..||||..|:...|||..||.|.||:||:|::||.:|:.:...:        .|::|.:|...
Yeast    35 SGATCRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICHYPIQF 99

  Fly    96 HT--------KIKPFNEWRSLDI-SGIERRRLCYSVLFHCAAALCVI-----WSL 136
            .|        || ||:...|..| :..|:.||..::  ..||.|.:|     |::
Yeast   100 KTIYAENMPEKI-PFSLLLSKSILTFFEKARLALTI--GLAAVLYIIGVPLVWNM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 20/55 (36%)
SSM4NP_012234.3 SSM4 22..1319 CDD:227510 39/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I2590
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.