DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and AT1G02610

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_171761.2 Gene:AT1G02610 / 837915 AraportID:AT1G02610 Length:221 Species:Arabidopsis thaliana


Alignment Length:161 Identity:47/161 - (29%)
Similarity:77/161 - (47%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELC----KFPFIMHT 97
            ::|.:.||||| |.:.::....||.|||::|:.|:.|:|:|........||:|    |..:...:
plant    14 KSSFNRCRICH-EEEAESYFEAPCSCSGTIKFAHRDCIQRWCDEKGNTICEICLQEYKPGYTTTS 77

  Fly    98 KIKPFNEWR-----SLDI----SGIER--RRL----------CYSVL---FHCAAALCVIWSLCV 138
            |...|.|..     :|.|    :|..|  |||          |.|.:   ..|...|.:|:|:.:
plant    78 KPSRFIETAVTIRDNLHIMRRENGRRRRNRRLVNREESDFQECNSGVDRGASCCRYLALIFSVIL 142

  Fly   139 LIERAADDVQRGLIDWPF--WTKLAVVTVGL 167
            ||:.|.|.|. |..::|:  :|.|.:..:|:
plant   143 LIKHAFDAVY-GTEEYPYTIFTVLTLKAIGI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 19/51 (37%)
AT1G02610NP_171761.2 RINGv 20..65 CDD:128983 18/45 (40%)
DUF3675 72..183 CDD:289213 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1133
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.