DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and AT1G11020

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_563883.1 Gene:AT1G11020 / 837644 AraportID:AT1G11020 Length:321 Species:Arabidopsis thaliana


Alignment Length:234 Identity:51/234 - (21%)
Similarity:90/234 - (38%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PCDNAKTSSDI----EHVDWNSGQHYANVRFGSGSSQASQNSGDI---------------CRICH 47
            |.|:.|.|...    :|.:.:|..       .|.:|..:.||.:|               |||| 
plant    10 PPDSQKLSDSAPLLGDHTNSSSAS-------PSAASVVAGNSDEIKAEEDLENDASSAPCCRIC- 66

  Fly    48 CESDPQ---NPLLTPCYCSGSLKYVHQACLQQWLTASE---TNSCELCKFPFIMHTKIKPF---N 103
            .|.|.:   :.|::||.|.|:.::||::||..|.:..|   .:.|..||..|  |.:::||   |
plant    67 LEDDSELLGDELISPCMCKGTQQFVHRSCLDHWRSVKEGFAFSHCTTCKAQF--HLRVEPFEDNN 129

  Fly   104 EWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLIDW---------PFWTK 159
            .||......:...|....|.......:.|:.....::::..:.......||         ||:..
plant   130 SWRRKAKFRLFVARDVLLVFLAVQTVIAVMAGFAYMMDKDGEFRNSFNDDWDRILSKHPIPFYYC 194

  Fly   160 LAVVTVGLTGGIVFMYIQCKAY----------LHLCHRW 188
            :.|::..:..|.:.:.:.|.|.          .:.|:.|
plant   195 IGVISFFVLTGFLGIILHCSALNGNDPRMAGCQNCCYGW 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 19/68 (28%)
AT1G11020NP_563883.1 RING_CH-C4HC3_MARCH 63..115 CDD:319409 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.