DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and AT5G62460

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001330074.1 Gene:AT5G62460 / 836366 AraportID:AT5G62460 Length:320 Species:Arabidopsis thaliana


Alignment Length:291 Identity:63/291 - (21%)
Similarity:96/291 - (32%) Gaps:121/291 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKP------ 101
            ||||. |.|....|.:||.|||||||.|:.|:|:|.......:||:|      |...:|      
plant    91 CRICQ-EEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDTTCEIC------HKSYQPGYTAPP 148

  Fly   102 ----------------------FNEWRSLDISGIERRRLCYSVLF----------------HCAA 128
                                  .|:.|.|.::..||.      .|                .|.:
plant   149 PPPADDTIIDIGEDWGNGVHLDLNDPRILAMAAAERH------FFDADYDEYADSNSSGAAFCRS 207

  Fly   129 ALCVIWSLCV------LIERAADDVQRGLIDWPFWTKLAVVTVGLTGGIVFMY-IQCKAYLHLCH 186
            |..::.:|.:      |....:||.:    |.|             ....|:: ::...:|..|:
plant   208 AALILMALLLLRHALNLTNNNSDDEE----DDP-------------SAFFFLFMLRAAGFLLPCY 255

  Fly   187 --RWKARNRILLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASGAAGGYCAHE 249
              .|    .|.::|...::....|    :||....|   :.|:|              ||     
plant   256 IMAW----AISILQRRRQRQEAAA----LAAAEVAF---MLHSG--------------GG----- 290

  Fly   250 ANCASMDNGGGGAEMGLHQQMQRLLNASPHH 280
                    |||....|||..:...|.::|||
plant   291 --------GGGQRRGGLHFAVPPELISNPHH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 22/46 (48%)
AT5G62460NP_001330074.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1133
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.