DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and AT5G38070

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_198623.1 Gene:AT5G38070 / 833787 AraportID:AT5G38070 Length:259 Species:Arabidopsis thaliana


Alignment Length:222 Identity:51/222 - (22%)
Similarity:88/222 - (39%) Gaps:44/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSSQASQNSGDI-------CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCEL 88
            |.|::.....|:       |||||.|.:..| :.|||.|||:||:.|..|:|:|........||:
plant    35 GVSESISAGADLCESKFVQCRICHDEDEDTN-MDTPCSCSGTLKFAHHNCVQRWCNEKGDTVCEI 98

  Fly    89 CKFPF---------IMHTKIKPFNEWRSLDISGIERRRL-------------CYSVLFH------ 125
            |:..:         :.|......|......|.|::.|..             .||  ||      
plant    99 CRQQYKPGYTAPRQLFHYTGISMNFGSDWGIEGLDLRNPYFLTWGDADDDHDLYS--FHSPTSLI 161

  Fly   126 CAAALCVIWSLCVLIERAADDVQRGLIDWPFWTKLAVVTVGLTGGIVFMYIQCKAYLHLCHRWKA 190
            |...:.:::.|.:.:..:...:..|:.|:.. |.|.:..|...|.::..|:..|:::.:....:.
plant   162 CCRLIALLFVLLLFLRHSLPVLLGGVDDFSI-TLLMLPLVRTLGILLIAYVFFKSFIVIQRCRQE 225

  Fly   191 RNRILL-----IQNAPEKIHPVAPPSP 212
            |:..|.     .:.||.:|....|..|
plant   226 RDTRLSGFSSDEETAPPRILMALPERP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 21/54 (39%)
AT5G38070NP_198623.1 RINGv 53..100 CDD:128983 21/47 (45%)
DUF3675 106..216 CDD:289213 19/112 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - mtm1133
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.