DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and AT5G03180

DIOPT Version :10

Sequence 1:NP_648305.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001190212.1 Gene:AT5G03180 / 831897 AraportID:AT5G03180 Length:466 Species:Arabidopsis thaliana


Alignment Length:119 Identity:26/119 - (21%)
Similarity:42/119 - (35%) Gaps:31/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ICRICHCE-SDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCK-----FPFIM----- 95
            :||||..| .:.:......|.|.|.|...|:.|..:|.|.....:|::||     .|..:     
plant   250 VCRICMVEMEEDEEAFKMECMCKGELALAHKTCTIKWFTIKGNITCDVCKQEVRNLPVTLLRVQD 314

  Fly    96 ---------HTKIKPFNE-WRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVL 139
                     ..:|..||. |:.:.|          .|:....|..|.:..|.::
plant   315 SQNRSRAARDIEISRFNNVWQDIPI----------LVIVSMLAYFCFLEQLLII 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_648305.1 RING_CH-C4HC3_MARCH1-like 42..93 CDD:438359 16/56 (29%)
AT5G03180NP_001190212.1 RINGv 250..299 CDD:128983 14/48 (29%)
ABC-2_lan_permease 337..>383 CDD:425375 5/32 (16%)
putative TM segment 361..379 CDD:409631
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.