powered by:
Protein Alignment CG4080 and AT4G32670
DIOPT Version :9
Sequence 1: | NP_001246695.1 |
Gene: | CG4080 / 39079 |
FlyBaseID: | FBgn0035983 |
Length: | 617 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001320116.1 |
Gene: | AT4G32670 / 829402 |
AraportID: | AT4G32670 |
Length: | 860 |
Species: | Arabidopsis thaliana |
Alignment Length: | 69 |
Identity: | 32/69 - (46%) |
Similarity: | 38/69 - (55%) |
Gaps: | 7/69 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 GSGS-------SQASQNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSC 86
|||. |..:..:.||||||....:|.|||..||.|.|||||:|..||..||...:.|.|
plant 12 GSGEAVTTEEVSDINNKAVDICRICQSPEEPDNPLRHPCACRGSLKYIHSDCLFLWLNRRKRNHC 76
Fly 87 ELCK 90
|:||
plant 77 EICK 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D170933at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.