DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and PIT1

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_567222.1 Gene:PIT1 / 828146 AraportID:AT4G02075 Length:218 Species:Arabidopsis thaliana


Alignment Length:156 Identity:41/156 - (26%)
Similarity:77/156 - (49%) Gaps:26/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPF-------IMHTKIK 100
            ||||| |.:.::....||.|||::|:.|:.|:|:|.......:||:|...:       :..:|: 
plant    20 CRICH-EEEEESFFEVPCACSGTVKFAHRNCIQRWCNEKGNTTCEICLQVYKDGYTAVLKQSKL- 82

  Fly   101 PFNEWRSLDISGIERRR------LCYSVLFHC------AAALC--VIWSLCV-LIERAADDVQRG 150
             ..:..::.::|..|||      :..|.:..|      .|:.|  :.::|.| |:.:...||..|
plant    83 -IEQEVTIRVNGRRRRRSRRLVSIAESDISQCNSVADRGASFCRSLTFTLSVFLLMKHTFDVIYG 146

  Fly   151 LIDWPFWTKLAVVTVGLTGGIVFMYI 176
            ..::|| :...|:|:...|.::.|:|
plant   147 TEEYPF-SVFTVLTLKAIGILLPMFI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 18/46 (39%)
PIT1NP_567222.1 RING-CH finger (C4HC3-type) 20..65 CDD:319409 18/45 (40%)
RINGv 20..65 CDD:128983 18/45 (40%)
DUF3675 72..176 CDD:372103 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1133
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.