DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and AT3G47550

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_190339.1 Gene:AT3G47550 / 823909 AraportID:AT3G47550 Length:288 Species:Arabidopsis thaliana


Alignment Length:130 Identity:39/130 - (30%)
Similarity:54/130 - (41%) Gaps:35/130 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMH----------- 96
            ||||. |.|....|..||.|:|||||.|:.|:|:|.......:||:|..|: .|           
plant    69 CRICQ-EEDSTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICHQPY-QHGYTAPPPPPPD 131

  Fly    97 -TKIKPFNEW-----------RSLDISGIERRRL-----CYSVLFHCAAALC-----VIWSLCVL 139
             |.|...::|           |.|.::..||..|     .||......||.|     ::.:|.:|
plant   132 ETIIHIGDDWENGVPLDLTDPRILAMAAAERHFLEADYDEYSENNSSGAAFCRSAALILMALLLL 196

  Fly   140  139
            plant   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 21/46 (46%)
AT3G47550NP_190339.1 RINGv 69..115 CDD:128983 21/46 (46%)
DUF3675 121..237 CDD:403581 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1133
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.