DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and AT3G06710

DIOPT Version :10

Sequence 1:NP_648305.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_187327.2 Gene:AT3G06710 / 819856 AraportID:AT3G06710 Length:245 Species:Arabidopsis thaliana


Alignment Length:54 Identity:14/54 - (25%)
Similarity:22/54 - (40%) Gaps:10/54 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LCVIWSL-------CVLIERAADDVQRGL-IDWPFWTKLAVVTVGL--TGGIVF 173
            :.|.|::       |:.:.....:|..|. .|:...||.|....||  .|.:||
plant     9 MVVPWAMAFILNTYCLSLHPLGQEVVVGFKRDYGMSTKSACFLNGLLYNGHLVF 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_648305.1 RING_CH-C4HC3_MARCH1-like 42..93 CDD:438359
AT3G06710NP_187327.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.