DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and march1

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_005168431.1 Gene:march1 / 797069 ZFINID:ZDB-GENE-081112-1 Length:503 Species:Danio rerio


Alignment Length:239 Identity:106/239 - (44%)
Similarity:143/239 - (59%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105
            ::|||||||.|.:.||:|||:|:|||::|||.||.||:.:|:|..|||||:.|||.|.:||..:|
Zfish   286 EVCRICHCEGDEECPLITPCHCTGSLRFVHQGCLHQWIKSSDTRCCELCKYDFIMETHLKPLRKW 350

  Fly   106 RSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQR---------------GLIDWP 155
            ..|.:|..|||::..||:||.||.:||||||.|||:|.|::::.               |::|||
Zfish   351 EKLHMSTSERRKIFCSVIFHLAAVVCVIWSLYVLIDRTAEEIRHSKNKALVRLSPLNAVGVLDWP 415

  Fly   156 FWTKLAVVTVGLTGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPEKIHPVAPPSPVAAHHQHF 220
            |||||.||.||.|||::|||||||.||.|..|.||.|||:.:||.|:          .|.:.::.
Zfish   416 FWTKLIVVAVGFTGGLIFMYIQCKVYLQLWRRLKAFNRIIFVQNCPD----------TARNGENR 470

  Fly   221 SEPLAHAGSTSGAVEINASGAAGGYCAHEANCASMDNGGGGAEM 264
            ...:..:..|.||||:.|              .......||.||
Zfish   471 PSQVTQSNGTHGAVEVPA--------------PQTQTNAGGVEM 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 29/47 (62%)
march1XP_005168431.1 Rubella_Capsid 152..>288 CDD:283420 0/1 (0%)
RING_CH-C4HC3_MARCH1_like 287..338 CDD:319612 31/50 (62%)
RING-CH finger (C4HC3-type) 288..334 CDD:319612 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7908
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - otm24220
orthoMCL 1 0.900 - - OOG6_106356
Panther 1 1.100 - - LDO PTHR45981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.