DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and zgc:158785

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001074165.1 Gene:zgc:158785 / 791214 ZFINID:ZDB-GENE-070112-1712 Length:231 Species:Danio rerio


Alignment Length:193 Identity:64/193 - (33%)
Similarity:90/193 - (46%) Gaps:37/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEWRS 107
            ||||| |......||:||.|:|||..||:.||:||||||.|:|||||.|.:.:....|||.||.|
Zfish    50 CRICH-EDSAAGDLLSPCECAGSLAMVHRVCLEQWLTASGTSSCELCHFQYALERLPKPFTEWLS 113

  Fly   108 LDISGIERRRLCYSV---LFHCAAALCVIWSLCVLIERAADDVQRGLIDWPF---WTKLAVVTVG 166
            ......:||.||..|   ||....|....| |||          :|.:|..:   ...:.::.:.
Zfish   114 APSMQQQRRTLCGDVICFLFITPLASLSGW-LCV----------QGAMDLYYSNGMEAVGLIILT 167

  Fly   167 LTGGIVFMY---IQCKAYLHLCHRWKARNRILLIQNAPEKIHPVAPPSPVAAHHQ------HF 220
            ||...::::   :..:.::||...|.|.|..:.:|          .|.|..|..:      ||
Zfish   168 LTLFTIYLFWTVVSLRYHIHLFRTWNATNPSVRLQ----------IPRPAKAQQRPKHLTMHF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 29/46 (63%)
zgc:158785NP_001074165.1 RINGv 49..96 CDD:128983 29/46 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.