DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and MARCHF4

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_065865.1 Gene:MARCHF4 / 57574 HGNCID:29269 Length:410 Species:Homo sapiens


Alignment Length:243 Identity:62/243 - (25%)
Similarity:98/243 - (40%) Gaps:58/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RFGSGSSQASQNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKF 91
            |:..|||..|.....:||||. :...|..||:||.|.||:|..||.||.:|::.....|||||.:
Human   147 RYSLGSSLDSGMRTPLCRICF-QGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYY 210

  Fly    92 PF-IMHTKIKPFNEWRSLDISGIERRRLCYSV---LFHCAAALCVIWSLCVLIERAADDVQRGLI 152
            .: ::....|...:|:::.::.||:.::..::   ||..|:...:|||......|          
Human   211 KYHVIAISTKNPLQWQAISLTVIEKVQVAAAILGSLFLIASISWLIWSTFSPSAR---------- 265

  Fly   153 DWPFWTKLAVVTVGLTGGIVFMYIQC---------------KAYLHLCHRWKARN----RILLIQ 198
             |.....|..:..|:.|   ||.:.|               |.:..:..:||..|    :.|..|
Human   266 -WQRQDLLFQICYGMYG---FMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYDKTKDLEDQ 326

  Fly   199 NAPEKIHP-----------------VAPPSPVAAHHQ---HFSEPLAH 226
            .|..:.:|                 ...|:|.....|   |.|.||:|
Human   327 KAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSH 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 22/47 (47%)
MARCHF4NP_065865.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..136
RINGv 163..208 CDD:128983 21/45 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..372 8/47 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.