Sequence 1: | NP_001246695.1 | Gene: | CG4080 / 39079 | FlyBaseID: | FBgn0035983 | Length: | 617 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065865.1 | Gene: | MARCHF4 / 57574 | HGNCID: | 29269 | Length: | 410 | Species: | Homo sapiens |
Alignment Length: | 243 | Identity: | 62/243 - (25%) |
---|---|---|---|
Similarity: | 98/243 - (40%) | Gaps: | 58/243 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 RFGSGSSQASQNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKF 91
Fly 92 PF-IMHTKIKPFNEWRSLDISGIERRRLCYSV---LFHCAAALCVIWSLCVLIERAADDVQRGLI 152
Fly 153 DWPFWTKLAVVTVGLTGGIVFMYIQC---------------KAYLHLCHRWKARN----RILLIQ 198
Fly 199 NAPEKIHP-----------------VAPPSPVAAHHQ---HFSEPLAH 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4080 | NP_001246695.1 | RINGv | 42..90 | CDD:128983 | 22/47 (47%) |
MARCHF4 | NP_065865.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 92..136 | ||
RINGv | 163..208 | CDD:128983 | 21/45 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 324..372 | 8/47 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 390..410 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |