DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf7

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_036018314.1 Gene:Marchf7 / 57438 MGIID:1931053 Length:730 Species:Mus musculus


Alignment Length:223 Identity:52/223 - (23%)
Similarity:79/223 - (35%) Gaps:86/223 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DNAKTSSDIEHVDWNS--GQHYANVRFGSGSSQ-----------------ASQNSGDICRICH-C 48
            ||...:.||....|||  |:   |.:..|..|:                 ..:..||:||||. .
Mouse   499 DNVMITVDIIPSGWNSTDGK---NDKAKSAPSRDPEKLQKIKESLLLEDSDDEEEGDLCRICQMA 560

  Fly    49 ESDPQNPLLTPCYCSGSLKYVHQACLQQWLTA--------SETNSCELCK--------------- 90
            .:...|.|:.||.|:|||:||||.|:::||.|        ....:|||||               
Mouse   561 AASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINSGSSLEAVTTCELCKEKLQLNLEDFDIHEL 625

  Fly    91 ----------FPFI---------MH-----------------TKIKPFNEWRSLDISGIERRRLC 119
                      :.||         :|                 |:::..|..|:|.....:...:.
Mouse   626 HRAHANEQAEYEFISSGLYLVVLLHLCEQSFSDMMGNTIEPSTRVRFINLARTLQAHMEDLETVI 690

  Fly   120 YSVLFHCAAALCV----IWSLCVLIERA 143
            ..:|..|..||.:    :|.:.:.|..|
Mouse   691 SQILLRCVRALALNSLSLWCMFIYISLA 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 23/56 (41%)
Marchf7XP_036018314.1 RING_Ubox 554..612 CDD:418438 25/57 (44%)
RING-CH finger (C4HC3-type) 554..609 CDD:319361 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.