DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and march8

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001314848.1 Gene:march8 / 567818 ZFINID:ZDB-GENE-080204-8 Length:580 Species:Danio rerio


Alignment Length:196 Identity:98/196 - (50%)
Similarity:132/196 - (67%) Gaps:23/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFN 103
            |||.|||||||.|.::||:|||:|:|||::|||||||||:.:|:|..|||||:.|||.||:||..
Zfish   348 SGDCCRICHCEGDDESPLITPCHCTGSLRFVHQACLQQWIKSSDTRCCELCKYDFIMETKLKPLR 412

  Fly   104 EWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRG------------------ 150
            :|..|.::..|||::..||.||..|..||:|||.|||:|.|:::::.                  
Zfish   413 KWEKLQMTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQAGRIPGGLKLHPGLAYGGS 477

  Fly   151 ---LIDWPFWTKLAVVTVGLTGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPE--KIHPVAPP 210
               :::|||||||.||.:|.|||:||||:|||.|:.|..|.||.||::.:||.||  ||.....|
Zfish   478 ESRILEWPFWTKLVVVAIGFTGGLVFMYVQCKVYIQLWRRLKAYNRVIYVQNRPETCKIKVFDKP 542

  Fly   211 S 211
            |
Zfish   543 S 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 31/47 (66%)
march8NP_001314848.1 RINGv 351..399 CDD:128983 31/47 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596565
Domainoid 1 1.000 88 1.000 Domainoid score I7908
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - otm24220
orthoMCL 1 0.900 - - OOG6_106356
Panther 1 1.100 - - O PTHR45981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.