DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and march2

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001038255.2 Gene:march2 / 555611 ZFINID:ZDB-GENE-050208-777 Length:249 Species:Danio rerio


Alignment Length:245 Identity:70/245 - (28%)
Similarity:103/245 - (42%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CD---NAKTSSDIEHVDWNSGQHYANVRFGSG-------SSQASQNSGDICRICH-----CESDP 52
            ||   ||..|..:|..|....|:...|....|       .:..:|:....|||||     |.|: 
Zfish    14 CDCTGNAALSKTVEEADNRRAQYVTQVTAKDGRLLSTVIKALGTQSDRPTCRICHEGQDVCNSE- 77

  Fly    53 QNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW-RSLDISGIERR 116
              .||:||.|:|:|..||::||::||::|.|:.||||...|.:..:.:|..|| |.......:|.
Zfish    78 --GLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIERRPRPLTEWLRDPGPRNEKRT 140

  Fly   117 RLCYSVLFHCAAALCVI--WSLCVLIERAADDVQRGLIDWPFWTKL-AVVTVGLTGGIVFMYI-- 176
            ..|..|.|.....|..|  | ||:   |.|.|      ...|.::| ||..:.||..:..:|:  
Zfish   141 LFCDMVCFLFITPLAAISGW-LCL---RGAQD------HLHFNSRLEAVGLIALTIALFTIYVLW 195

  Fly   177 -------QCKAYLHLCHRWKARNRILLIQNAPEKIHPVAPPSPVAAHHQH 219
                   .|:.|    ..|:..|         :|:..:.|.:..|...||
Zfish   196 TLVSFRYHCQLY----SEWRRTN---------QKVRLLIPDTKGAHSTQH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 25/52 (48%)
march2NP_001038255.2 RINGv 64..113 CDD:128983 25/51 (49%)
Vpu 176..>220 CDD:109608 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.