DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and MARCHF1

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001381888.1 Gene:MARCHF1 / 55016 HGNCID:26077 Length:545 Species:Homo sapiens


Alignment Length:166 Identity:88/166 - (53%)
Similarity:126/166 - (75%) Gaps:4/166 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105
            ::|||||||.|.::||:|||.|:|:|::|||:||.||:.:|:|..|||||:.|||.||:||..:|
Human   334 EVCRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLRKW 398

  Fly   106 RSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQR----GLIDWPFWTKLAVVTVG 166
            ..|.::..|||::..||.||..|..||:|||.|||:|.|:::::    |:::|||||||.||.:|
Human   399 EKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGNDNGVLEWPFWTKLVVVAIG 463

  Fly   167 LTGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPE 202
            .|||:||||:|||.|:.|..|.||.||::.:||.|:
Human   464 FTGGLVFMYVQCKVYVQLWRRLKAYNRVIFVQNCPD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 28/47 (60%)
MARCHF1NP_001381888.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I8014
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4583
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - otm40944
orthoMCL 1 0.900 - - OOG6_106356
Panther 1 1.100 - - LDO PTHR45981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.