DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and marchf8

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_031760833.1 Gene:marchf8 / 448095 XenbaseID:XB-GENE-944304 Length:602 Species:Xenopus tropicalis


Alignment Length:207 Identity:101/207 - (48%)
Similarity:140/207 - (67%) Gaps:21/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPF 102
            :|||:|||||||.|.::||:|||:|:|||.:|||||||||:.:|:|..||||||.|||.||:||.
 Frog   386 SSGDLCRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKFEFIMETKLKPL 450

  Fly   103 NEWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQ----RGLIDWPFWTKLAVV 163
            .:|..|.::..|||::..||.||..|..||:|||.|||:|.|::::    .|:::|||||||.||
 Frog   451 RKWEKLQMTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKMGQNNGILEWPFWTKLVVV 515

  Fly   164 TVGLTGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPEK-----------IHP-VAPPSPVAAH 216
            .:|.|||::|||:|||.|:.|..|.||.||::.:||.||.           |.| :.....:..|
 Frog   516 AIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETCKKKIFEKSVIIEPNLESKEALGIH 580

  Fly   217 H-----QHFSEP 223
            |     .:::||
 Frog   581 HSDTNSSYYTEP 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 31/47 (66%)
marchf8XP_031760833.1 RING_CH-C4HC3_MARCH1_like 390..441 CDD:319612 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7869
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - otm48139
Panther 1 1.100 - - O PTHR45981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.