DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and MARCHF11

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001096032.1 Gene:MARCHF11 / 441061 HGNCID:33609 Length:402 Species:Homo sapiens


Alignment Length:274 Identity:64/274 - (23%)
Similarity:103/274 - (37%) Gaps:99/274 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GSGSSQAS---QNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCK 90
            |.|..:|.   |:...||:||. :...|..||.||.|.||::|.||.||.:|::...:.:||||.
Human   153 GGGDQRAGHQHQHHQPICKICF-QGAEQGELLNPCRCDGSVRYTHQLCLLKWISERGSWTCELCC 216

  Fly    91 FPF-IMHTKIKPFNEWRSLDISGIERRRLCYSV---LFHCAAALCVIWSLCVLIERAADDVQRGL 151
            :.: ::..|:|...:|:|:.|:.:|:.::...:   ||..|:...::||              ..
Human   217 YRYHVIAIKMKQPCQWQSISITLVEKVQMIAVILGSLFLIASVTWLLWS--------------AF 267

  Fly   152 IDWPFWTK---LAVVTVGLTGGIVFMYIQC--------KAYLHLCHRWKA--------------- 190
            ..:..|.:   |..:..|:.|   ||.:.|        .|...:..||:|               
Human   268 SPYAVWQRKDILFQICYGMYG---FMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLNYDKATD 329

  Fly   191 ----------------------RNRILLIQNAPEKIHPVAPPSP------VAAH-------HQHF 220
                                  |||.|        :||....||      |..|       |:..
Human   330 IEESSRGESSTSRTLWLPLTALRNRNL--------VHPTQLTSPRFQCGYVLLHLFNRMRPHEDL 386

  Fly   221 SEPLAHAGSTSGAV 234
            ||     .::||.|
Human   387 SE-----DNSSGEV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 21/47 (45%)
MARCHF11NP_001096032.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..161 3/7 (43%)
RINGv 169..215 CDD:128983 20/46 (43%)
YXXL motif 371..374 1/2 (50%)
PDZ-binding 399..402
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.