DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf4

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001038998.1 Gene:Marchf4 / 381270 MGIID:2683550 Length:409 Species:Mus musculus


Alignment Length:244 Identity:58/244 - (23%)
Similarity:93/244 - (38%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGSGSSQASQNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFP 92
            :..|||..|.....:||||. :...|..||:||.|.||:|..||.||.:|::.....|||||.:.
Mouse   147 YSLGSSLDSGMRTPLCRICF-QGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYYK 210

  Fly    93 F-IMHTKIKPFNEWRSLDISGIERRRLCYSV---LFHCAAALCVIWSLCVLIERAADDVQRGLID 153
            : ::....|...:|:::.::.||:.::..::   ||..|:...:|||   ....:|        .
Mouse   211 YHVIAISTKNPLQWQAISLTVIEKVQIAAAILGSLFLIASISWLIWS---TFSPSA--------K 264

  Fly   154 WPFWTKLAVVTVGLTGGIVFMYIQC--------KAYLHLCHRWKARNRILLIQN----------- 199
            |.....|..:..|:.|   ||.:.|        .:...:..||:|.|:...:.|           
Mouse   265 WQRQDLLFQICYGMYG---FMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYDKTKDLEDQK 326

  Fly   200 --------------------APEKIHPVA-----------PPSPVAAHH 217
                                ..|...|.|           |..||:.||
Mouse   327 SGGRTNLQTSSSAQANLPSAEEEAASPPAREEGPTRAASHPSGPVSQHH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 22/47 (47%)
Marchf4NP_001038998.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..133
RING_CH-C4HC3_MARCH4_9 161..211 CDD:319725 23/50 (46%)
RING-CH finger (C4HC3-type) 162..207 CDD:319725 21/45 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..372 5/48 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.