Sequence 1: | NP_001246695.1 | Gene: | CG4080 / 39079 | FlyBaseID: | FBgn0035983 | Length: | 617 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038998.1 | Gene: | Marchf4 / 381270 | MGIID: | 2683550 | Length: | 409 | Species: | Mus musculus |
Alignment Length: | 244 | Identity: | 58/244 - (23%) |
---|---|---|---|
Similarity: | 93/244 - (38%) | Gaps: | 69/244 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 FGSGSSQASQNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFP 92
Fly 93 F-IMHTKIKPFNEWRSLDISGIERRRLCYSV---LFHCAAALCVIWSLCVLIERAADDVQRGLID 153
Fly 154 WPFWTKLAVVTVGLTGGIVFMYIQC--------KAYLHLCHRWKARNRILLIQN----------- 199
Fly 200 --------------------APEKIHPVA-----------PPSPVAAHH 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4080 | NP_001246695.1 | RINGv | 42..90 | CDD:128983 | 22/47 (47%) |
Marchf4 | NP_001038998.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 92..133 | ||
RING_CH-C4HC3_MARCH4_9 | 161..211 | CDD:319725 | 23/50 (46%) | ||
RING-CH finger (C4HC3-type) | 162..207 | CDD:319725 | 21/45 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 323..372 | 5/48 (10%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 389..409 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |