DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf2

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_038935345.1 Gene:Marchf2 / 362849 RGDID:1306395 Length:276 Species:Rattus norvegicus


Alignment Length:251 Identity:71/251 - (28%)
Similarity:108/251 - (43%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CDNAKT---SSDIEHVDWNSGQHYANV-----RFGSGSSQASQNSGD--ICRICHCESDPQNPLL 57
            ||.:.:   |..:|.......|:.|.|     |..|...:|.....|  .|||||..::.:| ||
  Rat    14 CDCSSSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDCPFCRICHEGANGEN-LL 77

  Fly    58 TPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEWRSLDISGIERRRLCYS- 121
            :||.|:|:|..||::||::||::|.|:.||||...|.:..:.:|..||........|:|.||.. 
  Rat    78 SPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDM 142

  Fly   122 VLFHCAAALCVI--WSLCVLIERAADDVQR--------GLIDWPFWTKLAVVTVGLTGGIVFMYI 176
            |.|.....|..|  | ||:   |.|.|..|        |||.    ..:|:.|:.:...:...:.
  Rat   143 VCFVFITPLAAISGW-LCL---RGAQDHLRLHSRLEAVGLIA----LTIALFTIYVLWTLRLEHF 199

  Fly   177 QCKAYLHL---CHRWKARNRILLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGS 229
            :.:|.|:|   |            :.||..:.|:..|:.:.........|....||
  Rat   200 EVEACLYLPTHC------------RTAPAGLFPIPLPAVLGMEEDQSESPAEDPGS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 24/47 (51%)
Marchf2XP_038935345.1 RING_CH-C4HC3_MARCH2 62..113 CDD:319722 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.