DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf1

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_017455664.2 Gene:Marchf1 / 361135 RGDID:1305148 Length:542 Species:Rattus norvegicus


Alignment Length:190 Identity:95/190 - (50%)
Similarity:134/190 - (70%) Gaps:16/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GSG-----SSQASQNSGD-------ICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTAS 81
            |||     |:|.|..:.|       :|||||||.|.::||:|||.|:|:|::|||:||.||:.:|
  Rat   307 GSGLQLNTSTQKSPGADDDGSENFEVCRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSS 371

  Fly    82 ETNSCELCKFPFIMHTKIKPFNEWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADD 146
            :|..|||||:.|||.||:||..:|..|.::..|||::..||.||..|..||:|||.|||:|.|::
  Rat   372 DTRCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCSVTFHVIAVTCVVWSLYVLIDRTAEE 436

  Fly   147 VQR----GLIDWPFWTKLAVVTVGLTGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPE 202
            :::    |:::|||||||.||.:|.|||:||||:|||.|:.|..|.||.||::.:||.|:
  Rat   437 IKQGNDNGVLEWPFWTKLVVVAIGFTGGLVFMYVQCKVYVQLWRRLKAYNRVIFVQNCPD 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 28/47 (60%)
Marchf1XP_017455664.2 RING_CH-C4HC3_MARCH1_like 332..383 CDD:319612 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7830
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - otm45080
orthoMCL 1 0.900 - - OOG6_106356
Panther 1 1.100 - - LDO PTHR45981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.