DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and CG17717

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster


Alignment Length:224 Identity:47/224 - (20%)
Similarity:81/224 - (36%) Gaps:66/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SSQASQNSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMH 96
            |..::..||:.||||....:....:..||.|.||:.|:|..||::|:.....|.||:|...|.: 
  Fly    80 SLHSANESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNI- 143

  Fly    97 TKIKPFNEWRSLDISGIERRRLCYSVLFHCAAALC------VIWSLCVL---------IERAADD 146
                           ..||..|...:...|....|      :::|..::         :.:..|:
  Fly   144 ---------------AEERASLKQMIRTFCCGRCCGLIVKHLLFSASLMPLAHIILQQVLQCMDN 193

  Fly   147 VQRGLIDWPFWTKLAVVTVGL--TGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPEKIHPVAP 209
            :.:|..|.....::.|.:..|  :..:.|.:.:.           ...|.:||:|          
  Fly   194 MNQGSTDQLTVQEVFVASCALLTSSALFFHFFEF-----------VTTRFMLIRN---------- 237

  Fly   210 PSPVAAHHQHFSEPLAHAGSTSG--AVEI 236
               :.:|...|       ||||.  .|||
  Fly   238 ---ILSHWWMF-------GSTSDFELVEI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 17/47 (36%)
CG17717NP_572327.1 RINGv 91..138 CDD:128983 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 1 1.000 - - X270
43.840

Return to query results.
Submit another query.