DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf8

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_008761465.1 Gene:Marchf8 / 312656 RGDID:1309339 Length:568 Species:Rattus norvegicus


Alignment Length:212 Identity:102/212 - (48%)
Similarity:141/212 - (66%) Gaps:11/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFN 103
            |||.|||||||.|.::||:|||:|:|||.:|||||||||:.:|:|..|||||:.|||.||:||..
  Rat   354 SGDACRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR 418

  Fly   104 EWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQR----GLIDWPFWTKLAVVT 164
            :|..|.::..|||::..||.||..|..||:|||.|||:|.|:::::    |:::|||||||.||.
  Rat   419 KWEKLQMTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQVTGILEWPFWTKLVVVA 483

  Fly   165 VGLTGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPEK-----IHPVAPPSPVAAHHQHFSEPL 224
            :|.|||::|||:|||.||.|..|.||.||::.:||.||.     ....|...|...:.:  ...:
  Rat   484 IGFTGGLLFMYVQCKVYLQLWKRLKAYNRVIYVQNCPETSKKNIFEKSALTEPTLENKE--GHGM 546

  Fly   225 AHAGSTSGAVEINASGA 241
            .|:.:.|...|...:||
  Rat   547 CHSTTNSSCTEPEDTGA 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 31/47 (66%)
Marchf8XP_008761465.1 RING_CH-C4HC3_MARCH1_like 357..408 CDD:319612 33/50 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354290
Domainoid 1 1.000 87 1.000 Domainoid score I7830
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - otm45080
orthoMCL 1 0.900 - - OOG6_106356
Panther 1 1.100 - - O PTHR45981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.700

Return to query results.
Submit another query.