DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf7

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_038960759.1 Gene:Marchf7 / 311059 RGDID:1308993 Length:713 Species:Rattus norvegicus


Alignment Length:187 Identity:45/187 - (24%)
Similarity:73/187 - (39%) Gaps:57/187 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DNAKTSSDIEHVDWNSGQHYANVRFGSGSSQASQNS-------------------------GDIC 43
            ||...:.||....|:|         ..|.|:.::::                         ||:|
  Rat   512 DNVTITVDIIPSGWSS---------ADGKSEKAKSAPSRDPEKLQKIKESLLLEDSDEEEEGDLC 567

  Fly    44 RICH-CESDPQNPLLTPCYCSGSLKYVHQACLQQWLTA--------SETNSCELCKFPFIMHTKI 99
            |||. ..:...|.|:.||.|:|||:||||.|:::||.|        ....:|||||....::.: 
  Rat   568 RICQMAAASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINSGSSLEAVTTCELCKEKLQLNLE- 631

  Fly   100 KPFNEWRSLDISGIERRRLCYSVLFHCAAA---LCVIWSLCVLIERAADDVQRGLID 153
                   ..||..:.|........:...::   |.|:..||   |::..|:....|:
  Rat   632 -------DFDIHELHRAHANEQAEYEFISSGLYLVVLLHLC---EQSFSDMMGNTIE 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 23/56 (41%)
Marchf7XP_038960759.1 RING_CH-C4HC3_MARCH7 564..625 CDD:319726 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.