powered by:
Protein Alignment CG4080 and Marchf10
DIOPT Version :9
Sequence 1: | NP_001246695.1 |
Gene: | CG4080 / 39079 |
FlyBaseID: | FBgn0035983 |
Length: | 617 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013995.1 |
Gene: | Marchf10 / 303596 |
RGDID: | 1311692 |
Length: | 790 |
Species: | Rattus norvegicus |
Alignment Length: | 64 |
Identity: | 30/64 - (46%) |
Similarity: | 38/64 - (59%) |
Gaps: | 9/64 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 SQNSGDICRICH-CESDPQNPLLTPCYCSGSLKYVHQACLQQWLTA--------SETNSCELCK 90
|:..||:||||. ....|.||||.||.|.|||::|||.||::||.. |...:||:||
Rat 634 SEEEGDLCRICQIAGGSPANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLSTVKTCEMCK 697
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.