DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf6

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_008759048.1 Gene:Marchf6 / 294862 RGDID:1565757 Length:914 Species:Rattus norvegicus


Alignment Length:244 Identity:59/244 - (24%)
Similarity:86/244 - (35%) Gaps:81/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105
            ||||:|..|..|:.||..||.|:||:|::||.||.|||..|....|||||..|            
  Rat     7 DICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRF------------ 59

  Fly   106 RSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLID--------WPFWTKLAV 162
                                   |...|:|..:.......|:..||:.        |..:|.:|.
  Rat    60 -----------------------AFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAF 101

  Fly   163 VTVGL-------------TGGIVFM----------------------YIQCKAYLHLCHRWKARN 192
            ..:|:             ||.:..:                      .:.|.....:...| .|.
  Rat   102 AWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLLADCLQGCFVVTCTLCAFISLVW-LRE 165

  Fly   193 RILLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASGA 241
            :| :...||..:...|||...|.|||: ..|:...|:.:.|.:..|:.|
  Rat   166 QI-VHGGAPIWLEHAAPPFNAAGHHQN-EAPVGGNGAENPAADQPANPA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 25/47 (53%)
Marchf6XP_008759048.1 RING_CH-C4HC3_MARCH6 8..57 CDD:319616 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.