DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf6

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_011243653.1 Gene:Marchf6 / 223455 MGIID:2442773 Length:914 Species:Mus musculus


Alignment Length:244 Identity:59/244 - (24%)
Similarity:86/244 - (35%) Gaps:81/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105
            ||||:|..|..|:.||..||.|:||:|::||.||.|||..|....|||||..|            
Mouse     7 DICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRF------------ 59

  Fly   106 RSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLID--------WPFWTKLAV 162
                                   |...|:|..:.......|:..||:.        |..:|.:|.
Mouse    60 -----------------------AFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAF 101

  Fly   163 VTVGL-------------TGGIVFM----------------------YIQCKAYLHLCHRWKARN 192
            ..:|:             ||.:..:                      .:.|.....:...| .|.
Mouse   102 AWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLLADCLQGCFVVTCTLCAFISLVW-LRE 165

  Fly   193 RILLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASGA 241
            :| :...||..:...|||...|.|||: ..|:...|:.:.|.:..|:.|
Mouse   166 QI-VHGGAPIWLEHAAPPFNAAGHHQN-EAPVGGNGAENPAADQPANPA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 25/47 (53%)
Marchf6XP_011243653.1 RING_CH-C4HC3_MARCH6 8..57 CDD:319616 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.