DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and MARCHF8

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001269795.1 Gene:MARCHF8 / 220972 HGNCID:23356 Length:573 Species:Homo sapiens


Alignment Length:168 Identity:94/168 - (55%)
Similarity:129/168 - (76%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFN 103
            |||:|||||||.|.::||:|||:|:|||.:|||||||||:.:|:|..|||||:.|||.||:||..
Human   358 SGDVCRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR 422

  Fly   104 EWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQR----GLIDWPFWTKLAVVT 164
            :|..|.::..|||::..||.||..|..||:|||.|||:|.|:::::    |:::|||||||.||.
Human   423 KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVA 487

  Fly   165 VGLTGGIVFMYIQCKAYLHLCHRWKARNRILLIQNAPE 202
            :|.|||::|||:|||.|:.|..|.||.||::.:||.||
Human   488 IGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPE 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 31/47 (66%)
MARCHF8NP_001269795.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..72
RINGv 361..409 CDD:128983 31/47 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160217
Domainoid 1 1.000 87 1.000 Domainoid score I8014
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - otm40944
orthoMCL 1 0.900 - - OOG6_106356
Panther 1 1.100 - - O PTHR45981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.