DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and Marchf9

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001028434.1 Gene:Marchf9 / 216438 MGIID:2446144 Length:348 Species:Mus musculus


Alignment Length:291 Identity:67/291 - (23%)
Similarity:115/291 - (39%) Gaps:76/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SSQASQNSG---DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPF 93
            |..:|.:||   ..||||. :...|..||:||.|.||::..||.||.:|::...:.|||||.|.:
Mouse    96 SLSSSLDSGLRTPQCRICF-QGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKY 159

  Fly    94 -IMHTKIKPFNEWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLIDWPFW 157
             ::....|...:|:::.::.||:.::          |..|:.||.::..          |.|..|
Mouse   160 QVLAISTKNPLQWQAISLTVIEKVQI----------AAIVLGSLFLVAS----------ISWLIW 204

  Fly   158 TKLA------------VVTVGLTGGIVFMYIQC--------KAYLHLCHRWKARNRILLIQNAPE 202
            :.|:            .:..|:.|   ||.:.|        .:...:..||:|.|:...:.|. :
Mouse   205 SSLSPSAKWQRQDLLFQICYGMYG---FMDVVCIGLIVHEGSSVYRIFKRWQAVNQQWKVLNY-D 265

  Fly   203 KIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASGAAGGYCAHEANCASMDNGGGGAEMGLH 267
            |...|                   .|.|.|    .|:|..|...:..:..|........|:   .
Mouse   266 KTKDV-------------------GGDTGG----GAAGKPGPRTSRTSPPAGAPTRPPAAQ---R 304

  Fly   268 QQMQRLL-NASPHHMLQMAAELEVPHSSSSA 297
            .:|:.|| ....:.:|.:..:|..|.:.||:
Mouse   305 MRMRTLLPQRCGYTILHLLGQLRPPDARSSS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 21/47 (45%)
Marchf9NP_001028434.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..96 67/291 (23%)
RINGv 109..155 CDD:128983 20/46 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304 8/38 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..348 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.