DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and marc-5

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_496624.3 Gene:marc-5 / 174876 WormBaseID:WBGene00013273 Length:601 Species:Caenorhabditis elegans


Alignment Length:235 Identity:65/235 - (27%)
Similarity:95/235 - (40%) Gaps:58/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SQASQNSGDICRICHC--ESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETN-----SCELCK 90
            :::..::..:||||||  ..|..:||::||.|||||:|||.:||..||..|...     .||||.
 Worm   315 ARSDMSNEPLCRICHCCWPPDSNDPLISPCRCSGSLQYVHVSCLMHWLDISSRKLHRPAICELCL 379

  Fly    91 FPFIMHTKIKPFNEWRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLIDWP 155
            :.: ...::..:.|.:                |..||.|                       |..
 Worm   380 YKY-RRRRVLKYREMK----------------LPQCAQA-----------------------DIR 404

  Fly   156 FWTKLAVVTVGLTGGIVFMYIQC----KAYLHLCHRWKARNRI--LLIQNAPEKIHPVAPPS--P 212
            |:| |.||.:.|.....|..:.|    |:|.....:.:.|||.  |.::.....:.|.||||  .
 Worm   405 FYT-LFVVAIVLMILSAFSTVVCFQLEKSYGLSSSQGELRNRTQPLNVEGVVSDVPPAAPPSLTA 468

  Fly   213 VAAHHQHFSEPLAHAGSTS--GAVEINASGAAGGYCAHEA 250
            ||...:..|.|....|:..  |.:.:|||.....|...||
 Worm   469 VATASEESSVPTVVLGARKRIGDITVNASTKDESYRREEA 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 27/54 (50%)
marc-5NP_496624.3 RING_CH-C4HC3_MARCH 325..378 CDD:319409 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I6931
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - mtm4782
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.