DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and marc-3

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_492502.2 Gene:marc-3 / 172767 WormBaseID:WBGene00007643 Length:431 Species:Caenorhabditis elegans


Alignment Length:198 Identity:49/198 - (24%)
Similarity:91/198 - (45%) Gaps:36/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ICRICHC--ESDPQ------NPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTK 98
            :||||.|  .|.|.      .||::||.|||::...|::||:.|||.:.|.:||:|||.|.:..|
 Worm    12 VCRICMCGETSIPYLGQQAGEPLISPCKCSGTMGLFHRSCLEHWLTLTSTTNCEICKFAFKIKQK 76

  Fly    99 IKPFNEWRSLDISGIERRRLCYSVLFHCAAALCVI----WSLCVLIERA-------------ADD 146
            .:.|.::  :...|.::.:...:.....|..|.::    :.:.:.:|.|             .|:
 Worm    77 SRNFIDY--IRQGGYKKLQSNRNPFIDFAFVLLILPFAFFGVFMSVEGALYAGRKYHYAFENRDN 139

  Fly   147 VQRGLIDWPFWTKL---AVVTVGLTGGIVFMYIQCKAYLHLCHR---WKARNRILLI---QNAPE 202
            .:.|.::....|.|   ..:.|.|.....|:.:...|..|...:   |:|:|:|:.:   .:|.:
 Worm   140 DENGNLEVRNQTSLECALFLFVALLLFSAFITLVVSALWHHFRQYKIWQAKNKIMFVVDQLDAEQ 204

  Fly   203 KIH 205
            .:|
 Worm   205 SMH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 23/55 (42%)
marc-3NP_492502.2 RING_Ubox 12..71 CDD:388418 26/58 (45%)
RING-CH finger (C4HC3-type) 13..67 CDD:319361 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.