DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and marc-4

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001348646.1 Gene:marc-4 / 171616 WormBaseID:WBGene00016903 Length:317 Species:Caenorhabditis elegans


Alignment Length:126 Identity:39/126 - (30%)
Similarity:65/126 - (51%) Gaps:16/126 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DIEHVDWNSGQHYANVRF----GSGSSQAS--QNSGDICRICHCE-SDPQNPLLTPCYCSGSLKY 68
            :.:.:|.:...::....|    |..||:.|  ..|.::|||||.. |...|||::||.|||:|.:
 Worm    42 ETDMIDESRATYWKGCEFLKASGLYSSKLSLQSASANMCRICHTSTSTRSNPLISPCRCSGTLLF 106

  Fly    69 VHQACLQQWLTAS-----ETNSCELCKFPFIMHTKIKPFNEWRSLDISGIERRRLCYSVLF 124
            ||:||:.:||..|     .:..||||.:.:    :.....:.:||.:..::|.....:|||
 Worm   107 VHKACVVRWLEMSTRKMVPSPRCELCGYDY----RRGNIFQMKSLHVPHVDRSSCLLNVLF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 25/53 (47%)
marc-4NP_001348646.1 RING_CH-C4HC3_MARCH 80..133 CDD:319409 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I6931
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4583
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001979
OrthoInspector 1 1.000 - - mtm4782
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.