DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and MARCHF6

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_005876.2 Gene:MARCHF6 / 10299 HGNCID:30550 Length:910 Species:Homo sapiens


Alignment Length:245 Identity:61/245 - (24%)
Similarity:85/245 - (34%) Gaps:85/245 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105
            ||||:|..|..|:.||..||.|:||:|::||.||.|||..|....|||||..|            
Human     7 DICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRF------------ 59

  Fly   106 RSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLID--------WPFWTKLAV 162
                                   |...|:|..:.......|:..||:.        |..:|.:|.
Human    60 -----------------------AFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAF 101

  Fly   163 VTVGL-------------TGGIVFM----------------------YIQCKAYLHLCHRWKARN 192
            ..:|:             ||.:..:                      .:.|.....:...| .|.
Human   102 AWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLLADCLQGCFVVTCTLCAFISLVW-LRE 165

  Fly   193 RILLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASGAA 242
            :| :...||..:...|||...|.|||:    .|.||. :||..:.|...|
Human   166 QI-VHGGAPIWLEHAAPPFNAAGHHQN----EAPAGG-NGAENVAADQPA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 25/47 (53%)
MARCHF6NP_005876.2 RING_CH-C4HC3_MARCH6 8..57 CDD:319616 26/48 (54%)
RING-CH finger (C4HC3-type) 9..55 CDD:319616 23/45 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..256 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.