Sequence 1: | NP_001246695.1 | Gene: | CG4080 / 39079 | FlyBaseID: | FBgn0035983 | Length: | 617 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005876.2 | Gene: | MARCHF6 / 10299 | HGNCID: | 30550 | Length: | 910 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 61/245 - (24%) |
---|---|---|---|
Similarity: | 85/245 - (34%) | Gaps: | 85/245 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105
Fly 106 RSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLID--------WPFWTKLAV 162
Fly 163 VTVGL-------------TGGIVFM----------------------YIQCKAYLHLCHRWKARN 192
Fly 193 RILLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASGAA 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4080 | NP_001246695.1 | RINGv | 42..90 | CDD:128983 | 25/47 (53%) |
MARCHF6 | NP_005876.2 | RING_CH-C4HC3_MARCH6 | 8..57 | CDD:319616 | 26/48 (54%) |
RING-CH finger (C4HC3-type) | 9..55 | CDD:319616 | 23/45 (51%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 185..256 | 11/30 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D170933at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R328 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.850 |