DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and marchf6

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_002938364.3 Gene:marchf6 / 100494185 XenbaseID:XB-GENE-5888572 Length:910 Species:Xenopus tropicalis


Alignment Length:224 Identity:56/224 - (25%)
Similarity:84/224 - (37%) Gaps:64/224 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEW 105
            ||||:|..|...:.||..||.|:||:|::||.||..||..|....|||||..|       .|...
 Frog     8 DICRVCRSEGTSEKPLYHPCVCTGSIKFIHQECLVLWLKHSRKEYCELCKHRF-------AFTPI 65

  Fly   106 RSLDI-SGIERRRLCYSVL----------FH----------------CAAALCV----IWSLCVL 139
            .|.|: |.:..:.:|..::          ||                |....|:    :.||..|
 Frog    66 YSPDMPSRLPIQDICAGLITSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGSVSSLLTL 130

  Fly   140 ------IERAADDVQRGLIDWPFWTKLAVVTVGLTGGIVFMYIQCKAYLHLCHRWKARNRILLIQ 198
                  .|....|..:|..         |||..|...|..::::.:.......:|       |.|
 Frog   131 PLDMLSTENLLADCLQGCF---------VVTCTLCAFISLVWLREQIVHGGAPQW-------LEQ 179

  Fly   199 NAPEKIHPVAP----PSPVAAHHQHFSEP 223
            |.|..::.:..    |:.:||.:....:|
 Frog   180 NQPPPLNVLGQQNEVPANIAADNMALDQP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 23/47 (49%)
marchf6XP_002938364.3 RING_CH-C4HC3_MARCH6 9..58 CDD:319616 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.